PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G13820.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 430aa    MW: 45763 Da    PI: 9.2141
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G13820.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.11.5e-23127171145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr+++ ++k+CErH++rgr+rsrk++e 
  OGLUM12G13820.2 127 DSEPGRCRRTDGKKWRCSRDAVVDQKYCERHINRGRHRSRKHVEG 171
                      689***************************************986 PP

2QLQ61.22.9e-215692137
              QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     ++FT++Q+++L++Q+l+yK+++an+PvP++Ll++i++
  OGLUM12G13820.2 56 GPFTPTQWMELEHQALIYKHIVANAPVPARLLLPIRR 92
                     59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-125692IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-155791IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.9575792IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.527127171IPR014977WRC domain
PfamPF088799.3E-20129170IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MAMATPTTNG SFLLGSGGYP GAQILSFSSS GHSGNGLDCG SSDVARMQGV LARVRGPFTP  60
TQWMELEHQA LIYKHIVANA PVPARLLLPI RRSLHPPVFP HFSSGGILGS SSLGWGSFQL  120
GYSGSADSEP GRCRRTDGKK WRCSRDAVVD QKYCERHINR GRHRSRKHVE GQSSHAAKAT  180
VPAIAQPPIG ASNGKLSGSH GVSNELTKTL ATNRMMLDKA NLIERSQDYT NQQHNILQNN  240
TKGDNWSEEM SSQADYAVIP AGSLMNTPQS ANLNPIPQQQ RCKQSLFGKG IQHDDIQLSI  300
SIPVDNSDLP TNYNKAQMDH VVGGSSNGGN NTRASWIPGS WEASIGGPLG EFFTNTSSAS  360
DDKGKSRHPP SLNLLADGHT TSPQLQSPTG VLQMTSFSSV PSSTVSSPAG SLCNGLLTSG  420
LVNAQTVQTL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2415570.0AK241557.1 Oryza sativa Japonica Group cDNA, clone: J065178H17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618984.10.0PREDICTED: growth-regulating factor 7 isoform X1
SwissprotQ6AWY20.0GRF7_ORYSJ; Growth-regulating factor 7
TrEMBLA0A0E0BSS90.0A0A0E0BSS9_9ORYZ; Uncharacterized protein
STRINGLOC_Os12g29980.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.13e-43growth-regulating factor 2